Trying cruncher.nlm.nih.gov... connected
National Center for Biotechnology Information (NCBI)

Experimental GENINFO(R) BLAST Network Service (Cruncher)

Mon Oct 30 02:52:08 EST 1995, Up 3 days, 14:21, load: 4.71, 2.25, 3.18

  If results of this search are reported or published, please mention that
  the computation was performed at the NCBI using the BLAST network service.
  Problems with the service should be reported to a local system administrator.

PEPTIDE SEQUENCE DATABASES
 nr  Non-redundant PDB+SwissProt+PIR+SPUpdate+GenPept+GPUpdate, updated daily
     for efficient, complete searches of the five component databases:
   pdb        Brookhaven Protein Data Bank, April 1995 Release
   swissprot  SWISS-PROT Release 31.0, March 1995
   pir        PIR Release 45.0 (complete), June 30, 1995
   spupdate   SWISS-PROT cumulative weekly update to the major release
   genpept    CDS translations from GenBank(R) Release 91, October 15, 1995
   gpupdate   cumulative daily updates to the major release of genpept
 kabatpro Kabat Sequences of Proteins of Immunological Interest, June 1995
 tfd      TFD transcription factor (protein) database Release 7.0, June 1993
 alu *    Translations of select Alu repeats from REPBASE
 
NUCLEOTIDE SEQUENCE DATABASES
 nr    Non-redundant PDB+GBUpdate+GenBank+EmblUpdate+EMBL, updated daily
       for efficient, complete searches of the four component databases:
   pdb        Brookhaven Protein Data Bank, April 1995 Release
   genbank    GenBank(R) Release 91 (no daily updates), October 15, 1995
   gbupdate   GenBank(R) cumulative daily updates to the major release
   embl       EMBL Data Library, Release 43.0, June 1995
   emblu      EMBL Data Library cumulative daily updates to the major release
 vector     Vector subset of GenBank(R), February 3rd, 1995
 alu *+     Select Alu repeats from REPBASE
 kabatnuc Kabat Sequences of Nucleic Acid of Immunological Interest, June 1995
 epd      Eukaryotic Promoter Database Release 43, June 1995
 dbest +  Database of Expressed Sequence Tags (cumulative daily update)
 dbsts +  Database of Sequence Tagged Sites Release 1.5, October 26, 1994
 
  * Databases that are not accessible through the NCBI Retrieve E-mail server.
  + The TBLASTX program is restricted to searching these databases.
==============================================================================
 You can obtain the BLAST documentation files, send a message consisting of
 just the word ``help'' (without the quotes) to: blast@ncbi.nlm.nih.gov
 Last modification dates: August 10th 95 for the E-mail server help, January 
 19th 94 for the BLAST manual and March 18th 95 for the BLAST FAQ.
==============================================================================
 For a free subscription to "NCBI News", the NCBI newsletter, send a request
 along with your name and postal mailing address to: info@ncbi.nlm.nih.gov
==============================================================================
 A new GenBank sequence submission tool, called BankIt, is now available
 through the NCBI's home page on the World Wide Web. The URL is 
 http://www.ncbi.nlm.nih.gov/
==============================================================================

BLASTP 1.4.8MP [20-June-1995] [Build 13:58:02 Oct 17 1995]

Reference:  Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers,
and David J. Lipman (1990).  Basic local alignment search tool.  J. Mol. Biol.
215:403-10.

Query=  MySequence, 311 bases, 1964 checksum.
        (311 letters)

Database:  SWISS-PROT Release 31.0
           43,470 sequences; 15,335,248 total letters.
Searching..................................................done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

sp|P27652|LUCI_RENRE RENILLA-LUCIFERIN 2-MONOOXYGENASE (E...  1666  2.2e-227  1
sp|P34913|HYES_HUMAN SOLUBLE EPOXIDE HYDROLASE (CEH) (EC ...    68  3.3e-06   4
sp|Q01398|DEH1_MORSP HALOACETATE DEHALOGENASE H-1 (EC 3.8...    59  6.8e-06   4
sp|P80299|HYES_RAT   SOLUBLE EPOXIDE HYDROLASE (CEH) (EC ...    67  0.0027    3
sp|P13001|BIOH_ECOLI BIOH PROTEIN.                              51  0.0053    3
sp|P22643|HALO_XANAU HALOALKANE DEHALOGENASE (EC 3.8.1.5).      56  0.021     2
sp|P26174|BCHO_RHOCA MAGNESIUM-CHELATASE 30 KD SUBUNIT.         75  0.034     1
sp|P19076|DMPD_PSEPU 2-HYDROXYMUCONIC SEMIALDEHYDE HYDROL...    67  0.046     2
sp|P23133|TODF_PSEPU 2-HYDROXY-6-OXO-2,4-HEPTADIENOATE HY...    61  0.056     3
sp|Q02104|LIP1_PSYIM LIPASE 1 PRECURSOR (EC 3.1.1.3) (TRI...    73  0.066     1
sp|P34914|HYES_MOUSE SOLUBLE EPOXIDE HYDROLASE (CEH) (EC ...    59  0.16      3
sp|P24640|LIP3_MORSP LIPASE 3 PRECURSOR (EC 3.1.1.3) (TRI...    69  0.22      1
sp|P09935|PERU_HUMAN THYROID PEROXIDASE 2 PRECURSOR (EC 1...    68  0.32      1
sp|P07202|PERT_HUMAN THYROID PEROXIDASE 1 PRECURSOR (EC 1...    68  0.32      1
sp|P24309|DBR1_YEAST LARIAT DEBRANCHING ENZYME (EC 3.1.-.-).    54  0.49      2
sp|P24464|CP48_RAT   CYTOCHROME P450 IVA8 (EC 1.14.14.1) ...    52  0.77      3
sp|P23106|XYLF_PSEPU 2-HYDROXYMUCONIC SEMIALDEHYDE HYDROL...    51  0.85      2
sp|P38139|YB54_YEAST PUTATIVE PEROXISOMAL LIPASE BEM1-KTR...    60  0.87      2
sp|P19723|POLG_PRSVP GENOME POLYPROTEIN (CONTAINS: NUCLEA...    45  0.9997    3
sp|P19724|POLG_PRSVW GENOME POLYPROTEIN (CONTAINS: NUCLEA...    45  0.9997    3
sp|P16273|PRPX_HORVU PATHOGEN-RELATED PROTEIN.                  51  0.99990   2
sp|P14599|A4_DROME   BETA-AMYLOID-LIKE PROTEIN PRECURSOR.       49  0.99992   2



>sp|P27652|LUCI_RENRE RENILLA-LUCIFERIN 2-MONOOXYGENASE (EC 1.13.12.5)
            (RENILLA-TYPE LUCIFERASE).
            Length = 311

 Score = 1666 (766.7 bits), Expect = 2.2e-227, P = 2.2e-227
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query:     1 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLW 60
             MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLW
Sbjct:     1 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLW 60

Query:    61 RHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHD 120
             RHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHD
Sbjct:    61 RHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHD 120

Query:   121 WGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNF 180
             WGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNF
Sbjct:   121 WGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNF 180

Query:   181 FVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNY 240
             FVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNY
Sbjct:   181 FVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNY 240

Query:   241 NAYLRASDDLPKMFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFSQEDAPDEMGKYIK 300
             NAYLRASDDLPKMFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFSQEDAPDEMGKYIK
Sbjct:   241 NAYLRASDDLPKMFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFSQEDAPDEMGKYIK 300

Query:   301 SFVERVLKNEQ 311
             SFVERVLKNEQ
Sbjct:   301 SFVERVLKNEQ 311


>sp|P34913|HYES_HUMAN SOLUBLE EPOXIDE HYDROLASE (CEH) (EC 3.3.2.3) (EPOXIDE
            HYDRATASE) (CYTOSOLIC EPOXIDE HYDROLASE).
            Length = 554

 Score = 68 (31.3 bits), Expect = 3.3e-06, Sum P(4) = 3.3e-06
 Identities = 8/26 (30%), Positives = 19/26 (73%)

Query:   115 IFVGHDWGACLAFHYSYEHQDKIKAI 140
             +F+GHDWG  L ++ +  + ++++A+
Sbjct:   329 VFIGHDWGGMLVWYMALFYPERVRAV 354

 Score = 47 (21.6 bits), Expect = 3.3e-06, Sum P(4) = 3.3e-06
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query:    46 AVIFLHGNAASSYLWRHVVP 65
             AV   HG   S Y WR+ +P
Sbjct:   259 AVCLCHGFPESWYSWRYQIP 278

 Score = 43 (19.8 bits), Expect = 3.3e-06, Sum P(4) = 3.3e-06
 Identities = 10/38 (26%), Positives = 17/38 (44%)

Query:   173 KMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKG 210
             K+      FV +     + R +  EE   Y++ FK+ G
Sbjct:   420 KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSG 457

 Score = 36 (16.6 bits), Expect = 3.3e-06, Sum P(4) = 3.3e-06
 Identities = 6/25 (24%), Positives = 15/25 (60%)

Query:   285 HFSQEDAPDEMGKYIKSFVERVLKN 309
             H++Q D P E+ + +  +++   +N
Sbjct:   523 HWTQMDKPTEVNQILIKWLDSDARN 547


>sp|Q01398|DEH1_MORSP HALOACETATE DEHALOGENASE H-1 (EC 3.8.1.3).
            Length = 294

 Score = 59 (27.2 bits), Expect = 6.8e-06, Sum P(4) = 6.8e-06
 Identities = 13/40 (32%), Positives = 18/40 (45%)

Query:    47 VIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGK 86
             V+ LHG   +  +W  V P +      +  DL G G S K
Sbjct:    29 VLMLHGFPQNRAMWARVAPQLAEHHTVVCADLRGYGDSDK 68

 Score = 49 (22.5 bits), Expect = 6.8e-06, Sum P(4) = 6.8e-06
 Identities = 12/38 (31%), Positives = 18/38 (47%)

Query:   268 EGAKKFPNTEFVKVKGLHFSQEDAPDEMGKYIKSFVER 305
             E AK+  NT    + G HF  +  P E  + +  F+ R
Sbjct:   255 EWAKRCNNTTNASLPGGHFFVDQFPAETSEILLKFLAR 292

 Score = 40 (18.4 bits), Expect = 6.8e-06, Sum P(4) = 6.8e-06
 Identities = 8/27 (29%), Positives = 13/27 (48%)

Query:   243 YLRASDDLPKMFIESDPGFFSNAIVEG 269
             +L+  +  P+  I  DP FF    + G
Sbjct:   153 FLQQPEPFPEHMIGQDPDFFYETCLFG 179

 Score = 35 (16.1 bits), Expect = 6.8e-06, Sum P(4) = 6.8e-06
 Identities = 6/24 (25%), Positives = 12/24 (50%)

Query:   117 VGHDWGACLAFHYSYEHQDKIKAI 140
             VGHD G       + +H + + ++
Sbjct:   102 VGHDRGGRTGHRMALDHPEAVLSL 125


>sp|P80299|HYES_RAT SOLUBLE EPOXIDE HYDROLASE (CEH) (EC 3.3.2.3) (EPOXIDE
            HYDRATASE) (CYTOSOLIC EPOXIDE HYDROLASE).
            Length = 554

 Score = 67 (30.8 bits), Expect = 0.0027, Sum P(3) = 0.0027
 Identities = 8/26 (30%), Positives = 18/26 (69%)

Query:   115 IFVGHDWGACLAFHYSYEHQDKIKAI 140
             +F+GHDW   L ++ +  H ++++A+
Sbjct:   328 VFIGHDWAGVLVWNMALFHPERVRAV 353

 Score = 42 (19.3 bits), Expect = 0.0027, Sum P(3) = 0.0027
 Identities = 7/20 (35%), Positives = 11/20 (55%)

Query:    46 AVIFLHGNAASSYLWRHVVP 65
             A+   HG   S + WR+ +P
Sbjct:   258 AICLCHGFPESWFSWRYQIP 277

 Score = 38 (17.5 bits), Expect = 0.0027, Sum P(3) = 0.0027
 Identities = 7/22 (31%), Positives = 12/22 (54%)

Query:   189 KIMRKLEPEEFAAYLEPFKEKG 210
             K+ +    EE   Y++ FK+ G
Sbjct:   436 KVSKITTEEEIEYYIQQFKKSG 457

 Score = 35 (16.1 bits), Expect = 0.0066, Sum P(3) = 0.0066
 Identities = 5/13 (38%), Positives = 9/13 (69%)

Query:   238 RNYNAYLRASDDL 250
             R + ++ R SDD+
Sbjct:   401 RTFKSFFRTSDDM 413


>sp|P13001|BIOH_ECOLI BIOH PROTEIN.
            Length = 256

 Score = 51 (23.5 bits), Expect = 0.0054, Sum P(3) = 0.0053
 Identities = 11/39 (28%), Positives = 20/39 (51%)

Query:   107 LLNLPKKIIFVGHDWGACLAFHYSYEHQDKIKAIVHAES 145
             L   P K I++G   G  +A   +  H ++++A+V   S
Sbjct:    69 LQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVAS 107

 Score = 46 (21.2 bits), Expect = 0.0054, Sum P(3) = 0.0053
 Identities = 10/38 (26%), Positives = 19/38 (50%)

Query:    47 VIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKS 84
             ++ LHG   ++ +WR +   +       + DL G G+S
Sbjct:    16 LVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRS 53

 Score = 41 (18.9 bits), Expect = 0.0054, Sum P(3) = 0.0053
 Identities = 6/10 (60%), Positives = 8/10 (80%)

Query:   154 DEWPDIEEDI 163
             DEWP I+ D+
Sbjct:   115 DEWPGIKPDV 124


>sp|P22643|HALO_XANAU HALOALKANE DEHALOGENASE (EC 3.8.1.5).
            Length = 310

 Score = 56 (25.8 bits), Expect = 0.021, Sum P(2) = 0.021
 Identities = 10/28 (35%), Positives = 16/28 (57%)

Query:    38 DSEKHAENAVIFLHGNAASSYLWRHVVP 65
             +    AE+  + LHG    SYL+R ++P
Sbjct:    41 EGNSDAEDVFLCLHGEPTWSYLYRKMIP 68

 Score = 53 (24.4 bits), Expect = 0.021, Sum P(2) = 0.021
 Identities = 18/74 (24%), Positives = 26/74 (35%)

Query:    68 EPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGACLAF 127
             E  AR I PD  G GKS K  +      + ++            + I  V  DWG  L  
Sbjct:    72 ESGARVIAPDFFGFGKSDKPVDEEDYTFEFHRNFLLALIERLDLRNITLVVQDWGGFLGL 131

Query:   128 HYSYEHQDKIKAIV 141
                     + K ++
Sbjct:   132 TLPMADPSRFKRLI 145


>sp|P26174|BCHO_RHOCA MAGNESIUM-CHELATASE 30 KD SUBUNIT.
            Length = 284

 Score = 75 (34.5 bits), Expect = 0.035, P = 0.034
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query:    47 VIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRL 94
             ++ LHG  AS + +R ++P +    R I+PDL G G S  +    + L
Sbjct:    39 LLLLHGLGASGHSFRKMIPGLSARYRVIVPDLPGHGCSRSTARNRFGL 86


>sp|P19076|DMPD_PSEPU 2-HYDROXYMUCONIC SEMIALDEHYDE HYDROLASE (EC 3.1.1.-)
            (HMSH).
            Length = 283

 Score = 67 (30.8 bits), Expect = 0.048, Sum P(2) = 0.046
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query:    60 WRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSY 92
             WR V+P +    R I PD++G G S +  +  Y
Sbjct:    48 WRLVMPELAKSRRVIAPDMLGFGYSERPADAQY 80

 Score = 39 (17.9 bits), Expect = 0.048, Sum P(2) = 0.046
 Identities = 6/25 (24%), Positives = 15/25 (60%)

Query:   117 VGHDWGACLAFHYSYEHQDKIKAIV 141
             VG+ +G  +A   +  H ++++ +V
Sbjct:   104 VGNSFGGGIALALAIRHPERVRRLV 128


>sp|P23133|TODF_PSEPU 2-HYDROXY-6-OXO-2,4-HEPTADIENOATE HYDROLASE (HOHH) (EC
            3.1.1.-).
            Length = 276

 Score = 61 (28.1 bits), Expect = 0.057, Sum P(3) = 0.056
 Identities = 14/53 (26%), Positives = 24/53 (45%)

Query:    60 WRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPK 112
             WR V+P +    R I PD++G G + +     Y +     +L    + L L +
Sbjct:    46 WRTVMPELSRHRRVIAPDMVGFGFTQRPHGIHYGVESWVAHLAGILDALELDR 98

 Score = 35 (16.1 bits), Expect = 0.057, Sum P(3) = 0.056
 Identities = 6/18 (33%), Positives = 9/18 (50%)

Query:    43 AENAVIFLHGNAASSYLW 60
             A N V+ +HG+      W
Sbjct:    26 AGNPVVLVHGSGPGVTAW 43

 Score = 35 (16.1 bits), Expect = 0.057, Sum P(3) = 0.056
 Identities = 5/29 (17%), Positives = 16/29 (55%)

Query:   113 KIIFVGHDWGACLAFHYSYEHQDKIKAIV 141
             ++  VG+ +G  L+  ++     +++ +V
Sbjct:    98 RVDLVGNSFGGALSLAFAIRFPHRVRRLV 126


>sp|Q02104|LIP1_PSYIM LIPASE 1 PRECURSOR (EC 3.1.1.3) (TRIACYLGLYCEROL LIPASE).
            Length = 317

 Score = 73 (33.6 bits), Expect = 0.069, P = 0.066
 Identities = 18/67 (26%), Positives = 31/67 (46%)

Query:    74 IIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGACLAFHYSYEH 133
             IIPDL+G G+S K  +  YR       L    +   L   I   G+  G  ++  Y+ ++
Sbjct:    96 IIPDLLGFGESSKPMSADYRSEAQRTRLHELLQAKGLASNIHVGGNSMGGAISVAYAAKY 155

Query:   134 QDKIKAI 140
                +K++
Sbjct:   156 PKDVKSL 162


>sp|P34914|HYES_MOUSE SOLUBLE EPOXIDE HYDROLASE (CEH) (EC 3.3.2.3) (EPOXIDE
            HYDRATASE) (CYTOSOLIC EPOXIDE HYDROLASE).
            Length = 553

 Score = 59 (27.2 bits), Expect = 0.17, Sum P(3) = 0.16
 Identities = 6/26 (23%), Positives = 18/26 (69%)

Query:   115 IFVGHDWGACLAFHYSYEHQDKIKAI 140
             +F+GHDW   + ++ +  + ++++A+
Sbjct:   327 VFIGHDWAGVMVWNMALFYPERVRAV 352

 Score = 40 (18.4 bits), Expect = 0.17, Sum P(3) = 0.16
 Identities = 7/20 (35%), Positives = 11/20 (55%)

Query:    46 AVIFLHGNAASSYLWRHVVP 65
             A+   HG   S + WR+ +P
Sbjct:   257 ALCLCHGFPESWFSWRYQIP 276

 Score = 34 (15.6 bits), Expect = 0.17, Sum P(3) = 0.16
 Identities = 6/14 (42%), Positives = 9/14 (64%)

Query:   197 EEFAAYLEPFKEKG 210
             EE   Y++ FK+ G
Sbjct:   443 EEIEFYIQQFKKTG 456


>sp|P24640|LIP3_MORSP LIPASE 3 PRECURSOR (EC 3.1.1.3) (TRIACYLGLYCEROL LIPASE).
            Length = 315

 Score = 69 (31.8 bits), Expect = 0.25, P = 0.22
 Identities = 18/67 (26%), Positives = 29/67 (43%)

Query:    74 IIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGACLAFHYSYEH 133
             IIPDL+G G S K     YR       L    +   L       G+  G  ++  Y+ ++
Sbjct:    96 IIPDLLGFGNSSKPMTADYRADAQATRLHELMQAKGLASNTHVGGNSMGGAISVAYAAKY 155

Query:   134 QDKIKAI 140
               +IK++
Sbjct:   156 PKEIKSL 162


>sp|P09935|PERU_HUMAN THYROID PEROXIDASE 2 PRECURSOR (EC 1.11.1.8).
            Length = 876

 Score = 68 (31.3 bits), Expect = 0.39, P = 0.32
 Identities = 18/66 (27%), Positives = 30/66 (45%)

Query:   190 IMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDD 249
             I R L PE F  Y+ P++       PT+S        + G   +  +VR  +A  +   D
Sbjct:   454 IPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAFRFGHATIHPLVRRLDASFQEHPD 513

Query:   250 LPKMFI 255
             LP +++
Sbjct:   514 LPGLWL 519


>sp|P07202|PERT_HUMAN THYROID PEROXIDASE 1 PRECURSOR (EC 1.11.1.8).
            Length = 933

 Score = 68 (31.3 bits), Expect = 0.39, P = 0.32
 Identities = 18/66 (27%), Positives = 30/66 (45%)

Query:   190 IMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDD 249
             I R L PE F  Y+ P++       PT+S        + G   +  +VR  +A  +   D
Sbjct:   454 IPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAFRFGHATIHPLVRRLDASFQEHPD 513

Query:   250 LPKMFI 255
             LP +++
Sbjct:   514 LPGLWL 519


>sp|P24309|DBR1_YEAST LARIAT DEBRANCHING ENZYME (EC 3.1.-.-).
            Length = 405

 Score = 54 (24.9 bits), Expect = 0.67, Sum P(2) = 0.49
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query:    30 LDSFINYYDSEKHAENAVIFLHGNAAS 56
             L  FI+YY++E  A    IF+ GN  S
Sbjct:    62 LGDFISYYNNEIEAPVPTIFIGGNHES 88

 Score = 45 (20.7 bits), Expect = 0.67, Sum P(2) = 0.49
 Identities = 8/24 (33%), Positives = 13/24 (54%)

Query:   115 IFVGHDWGACLAFHYSYEHQDKIK 138
             I + HDW   + +H   +H  K+K
Sbjct:   175 IMLSHDWPNGVVYHGDTKHLLKLK 198


>sp|P24464|CP48_RAT CYTOCHROME P450 IVA8 (EC 1.14.14.1) (P450-KP1) (P450-PP1).
            Length = 508

 Score = 52 (23.9 bits), Expect = 1.5, Sum P(3) = 0.77
 Identities = 9/21 (42%), Positives = 15/21 (71%)

Query:   234 VQIVRNYNAYLRASDDLPKMF 254
             VQ+ R Y +Y++A +DL  +F
Sbjct:   206 VQLDRKYKSYIKAVEDLNNLF 226

 Score = 39 (17.9 bits), Expect = 1.5, Sum P(3) = 0.77
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query:    81 MGKSGKSGNGSYRLL 95
             +G+S    +GSYR L
Sbjct:   107 LGRSDPKAHGSYRFL 121

 Score = 34 (15.6 bits), Expect = 1.5, Sum P(3) = 0.77
 Identities = 6/12 (50%), Positives = 9/12 (75%)

Query:     4 KVYDPEQRKRMI 15
             +VYDPE  K ++
Sbjct:    96 QVYDPEYMKLIL 107


>sp|P23106|XYLF_PSEPU 2-HYDROXYMUCONIC SEMIALDEHYDE HYDROLASE (EC 3.1.1.-)
            (HMSH).
            Length = 281

 Score = 51 (23.5 bits), Expect = 1.9, Sum P(2) = 0.85
 Identities = 9/21 (42%), Positives = 13/21 (61%)

Query:    72 RCIIPDLIGMGKSGKSGNGSY 92
             R I PD++G G S +  +G Y
Sbjct:    59 RVIAPDMLGFGYSERPADGKY 79

 Score = 43 (19.8 bits), Expect = 1.9, Sum P(2) = 0.85
 Identities = 9/30 (30%), Positives = 17/30 (56%)

Query:   117 VGHDWGACLAFHYSYEHQDKIKAIVHAESV 146
             VG+ +G  LA   +  H ++++ +V   SV
Sbjct:   103 VGNSFGGGLALALAIRHPERVRRLVLMGSV 132


>sp|P38139|YB54_YEAST PUTATIVE PEROXISOMAL LIPASE BEM1-KTR3 INTERGENIC REGION
            (EC 3.1.1.-).
            Length = 375

 Score = 60 (27.6 bits), Expect = 2.1, Sum P(2) = 0.87
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query:   113 KIIFVGHDWGACLAFHYSYEHQDKIKAI 140
             KI+ VGH  G  LA H   +H    KA+
Sbjct:   170 KIVLVGHSMGCFLACHLYEQHMADTKAV 197

 Score = 35 (16.1 bits), Expect = 2.1, Sum P(2) = 0.87
 Identities = 8/37 (21%), Positives = 20/37 (54%)

Query:   158 DIEEDIALIKSEEGEKMVLENNFFVETMLPSKIMRKL 194
             D+++ I +  +E+     +EN  F +  +  + +RK+
Sbjct:   307 DMKQKIIIFGAEKDPIAPIENLEFYKQTINKECLRKV 343


>sp|P19723|POLG_PRSVP GENOME POLYPROTEIN (CONTAINS: NUCLEAR INCLUSION PROTEIN B
            (NI-B) (RNA-DIRECTED RNA POLYMERASE) (EC 2.7.7.48); COAT PROTEIN)
            (FRAGMENT).
            Length = 675

 Score = 45 (20.7 bits), Expect = 8.0, Sum P(3) = 1.0
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query:   274 PNTEFVKVKGLHFSQEDAPDEMGKYIKSFVER 305
             P    V ++ L+ S+  + DE+  YI  + ER
Sbjct:   324 PYVSEVGLRRLYTSERGSMDELEAYIDKYFER 355

 Score = 41 (18.9 bits), Expect = 8.0, Sum P(3) = 1.0
 Identities = 10/17 (58%), Positives = 10/17 (58%)

Query:   193 KLEPEEFAAYLEPFKEK 209
             KLEPE   A LE  K K
Sbjct:   259 KLEPERIVAILEWDKSK 275

 Score = 35 (16.1 bits), Expect = 8.0, Sum P(3) = 1.0
 Identities = 5/10 (50%), Positives = 7/10 (70%)

Query:   124 CLAFHYSYEH 133
             C+A H  +EH
Sbjct:   205 CIAIHPDHEH 214


>sp|P19724|POLG_PRSVW GENOME POLYPROTEIN (CONTAINS: NUCLEAR INCLUSION PROTEIN B
            (NI-B) (RNA-DIRECTED RNA POLYMERASE) (EC 2.7.7.48); COAT PROTEIN)
            (FRAGMENT).
            Length = 675

 Score = 45 (20.7 bits), Expect = 8.0, Sum P(3) = 1.0
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query:   274 PNTEFVKVKGLHFSQEDAPDEMGKYIKSFVER 305
             P    V ++ L+ S+  + DE+  YI  + ER
Sbjct:   324 PYVSEVGLRRLYTSERGSMDELEAYIDKYFER 355

 Score = 41 (18.9 bits), Expect = 8.0, Sum P(3) = 1.0
 Identities = 10/17 (58%), Positives = 10/17 (58%)

Query:   193 KLEPEEFAAYLEPFKEK 209
             KLEPE   A LE  K K
Sbjct:   259 KLEPERIVAILEWDKSK 275

 Score = 35 (16.1 bits), Expect = 8.0, Sum P(3) = 1.0
 Identities = 5/10 (50%), Positives = 7/10 (70%)

Query:   124 CLAFHYSYEH 133
             C+A H  +EH
Sbjct:   205 CIAIHPDHEH 214


>sp|P16273|PRPX_HORVU PATHOGEN-RELATED PROTEIN.
            Length = 192

 Score = 51 (23.5 bits), Expect = 9.3, Sum P(2) = 1.0
 Identities = 8/17 (47%), Positives = 10/17 (58%)

Query:    49 FLHGNAASSYLWRHVVP 65
             FLHG+     +WRH  P
Sbjct:    14 FLHGDGEKKTVWRHGAP 30

 Score = 36 (16.6 bits), Expect = 9.3, Sum P(2) = 1.0
 Identities = 5/11 (45%), Positives = 7/11 (63%)

Query:   213 RRPTLSWPREI 223
             R P+  WPR +
Sbjct:   174 RAPSARWPRRV 184


>sp|P14599|A4_DROME BETA-AMYLOID-LIKE PROTEIN PRECURSOR.
            Length = 886

 Score = 49 (22.5 bits), Expect = 9.4, Sum P(2) = 1.0
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query:   128 HYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIAL 165
             H SY+   K     H E V  V++ W +  +  +D+ L
Sbjct:   408 HQSYKVSQKRLEESHREKVTRVMKDWSDLEEKYQDMRL 445

 Score = 44 (20.2 bits), Expect = 9.4, Sum P(2) = 1.0
 Identities = 7/19 (36%), Positives = 13/19 (68%)

Query:   233 VVQIVRNYNAYLRASDDLP 251
             + Q++ +Y   LR+ DD+P
Sbjct:   589 IAQLMNDYILALRSKDDIP 607

Parameters:
  V=50
  B=50
  -matrix=BLOSUM62
  -sort_by_pvalue

  -ctxfactor=1.00
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.138   0.419    same    same    same

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +0      0      311       311      10. 59 3  11 22    0.20 34

Statistics:
  Query          Expected         Observed           HSPs       HSPs
  Frame  MatID  High Score       High Score       Reportable  Reported
   +0      0    63 (29.0 bits)  1666 (766.7 bits)      50         50

  Query         Neighborhd  Word      Excluded    Failed   Successful  Overlaps
  Frame  MatID   Words      Hits        Hits    Extensions Extensions  Excluded
   +0      0      9264    10316866     2251326     8053355    12184        14

  Database:  SWISS-PROT Release 31.0
    Release date:  March 1995
    Posted date:  1:06 PM EST Mar 21, 1995
  # of letters in database:  15,335,248
  # of sequences in database:  43,470
  # of database sequences satisfying E:  22
  No. of states in DFA:  577 (57 KB)
  Total size of DFA:  151 KB (192 KB)
  Time to generate neighborhood:  0.05u 0.01s 0.06t  Real: 00:00:00
  No. of processors used:  8
  Time to search database:  58.96u 1.01s 59.97t  Real: 00:00:10
  Total cpu time:  59.06u 1.07s 60.13t  Real: 00:00:10


If you have problems or comments...

Back to the ExPASy Molecular Biology Server home page